General Information

  • ID:  hor004596
  • Uniprot ID:  P33248
  • Protein name:  Thymosin beta-12
  • Gene name:  NA
  • Organism:  Lateolabrax japonicus (Japanese sea perch) (Japanese sea bass)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lateolabrax (genus), Lateolabracidae (family), Pempheriformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDISEVTSFDKTKLKKTETQEKNPLPSKETIEQEKAAATS
  • Length:  43(2-44)
  • Propeptide:  MSDKPDISEVTSFDKTKLKKTETQEKNPLPSKETIEQEKAAATS
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P33248-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004596_AF2.pdbhor004596_ESM.pdb

Physical Information

Mass: 552859 Formula: C205H342N54O76
Absent amino acids: CGHMRWY Common amino acids: K
pI: 4.96 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -133.02 Boman Index: -12943
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50
Instability Index: 3840.7 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1731637
  • Title:  Primary structure of thymosin beta 12, a new member of the beta-thymosin family isolated from perch liver.